powered by:
Protein Alignment CG11035 and AT1G65280
DIOPT Version :9
Sequence 1: | NP_001303469.1 |
Gene: | CG11035 / 40953 |
FlyBaseID: | FBgn0037544 |
Length: | 231 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001323409.1 |
Gene: | AT1G65280 / 842835 |
AraportID: | AT1G65280 |
Length: | 588 |
Species: | Arabidopsis thaliana |
Alignment Length: | 66 |
Identity: | 22/66 - (33%) |
Similarity: | 36/66 - (54%) |
Gaps: | 1/66 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 SHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKG 91
|.||.||:......:.:|..|:|||:|.|||:....: |.:.|..:|:|::.|.:...|:..|..
plant 305 SPYDVLGVNHNMAADNMKKRYWKLSLLVHPDKCSHPQ-AQEAFVLLNKAFKELQDPEKRKAMDDK 368
Fly 92 I 92
|
plant 369 I 369
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11035 | NP_001303469.1 |
DnaJ |
26..>89 |
CDD:223560 |
20/61 (33%) |
DnaJ |
27..89 |
CDD:278647 |
20/61 (33%) |
AT1G65280 | NP_001323409.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.