DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and DNAJC30

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_115693.2 Gene:DNAJC30 / 84277 HGNCID:16410 Length:226 Species:Homo sapiens


Alignment Length:223 Identity:72/223 - (32%)
Similarity:105/223 - (47%) Gaps:46/223 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WRPLLLLRG--------LYLSQR---------HQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHP 56
            || ||..||        |.|..|         .:.:.||.||:....||.:||||||:...||||
Human    15 WR-LLQARGFPQNSAPSLGLGARTYSQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHP 78

  Fly    57 DRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVE-------- 113
            |||.||..||::|..|:|||.:||:..|||.||:|::..         .|:..|.|.        
Human    79 DRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSD---------EDLRGPGVRPSRTPAPD 134

  Fly   114 -DDAETKFYKSR-FQKSRVSDSAGRTPIYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRI 176
             ....|....|| ...||.|..|.|| :::||.:.:.|||:..:|.:..:|:.:.::.::|...:
Human   135 PGSPRTPPPTSRTHDGSRASPGANRT-MFNFDAFYQAHYGEQLERERRLRARREALRKRQEYRSM 198

  Fly   177 SG-------QTDMVLLAF-IFAGVAVYL 196
            .|       .|..:.|.| ||..:..|:
Human   199 KGLRWEDTRDTAAIFLIFSIFIIIGFYI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 33/62 (53%)
DnaJ 27..89 CDD:278647 33/61 (54%)
DNAJC30NP_115693.2 DnaJ 50..111 CDD:278647 33/60 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..157 9/49 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8993
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I5061
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51945
OrthoDB 1 1.010 - - D1404041at2759
OrthoFinder 1 1.000 - - FOG0007820
OrthoInspector 1 1.000 - - oto88854
orthoMCL 1 0.900 - - OOG6_105154
Panther 1 1.100 - - LDO PTHR44873
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5453
SonicParanoid 1 1.000 - - X4983
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.