DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AT1G56300

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_564717.1 Gene:AT1G56300 / 842083 AraportID:AT1G56300 Length:156 Species:Arabidopsis thaliana


Alignment Length:93 Identity:34/93 - (36%)
Similarity:50/93 - (53%) Gaps:20/93 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SHYDALGIRRQCTQNEIKAAYYKLSMLYHPD---RNQGSENAAK-KFREINQAYEILGNYRLRRL 87
            |:|..||||:..:.::|:.||.||:|.:|||   ||.|....|| :|::|.:||.:|.:...|.:
plant    13 SYYTILGIRKDASVSDIRTAYRKLAMKWHPDRYARNPGVAGEAKRRFQQIQEAYSVLNDENKRSM 77

  Fly    88 YDKGIVHTAGAQYAQDVHDVAEPVVEDD 115
            ||.|:         .|.|       |||
plant    78 YDVGL---------YDPH-------EDD 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 26/65 (40%)
DnaJ 27..89 CDD:278647 26/65 (40%)
AT1G56300NP_564717.1 DnaJ 13..79 CDD:278647 26/65 (40%)
DnaJ 13..>79 CDD:223560 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.