DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AT5G59610

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001330548.1 Gene:AT5G59610 / 836080 AraportID:AT5G59610 Length:279 Species:Arabidopsis thaliana


Alignment Length:199 Identity:51/199 - (25%)
Similarity:73/199 - (36%) Gaps:40/199 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRL 87
            |.:.|.|:.||:....|..:||.||.||::.||||.|: ..||.:||.:|..||..|.|...||.
plant    69 RARSSPYEILGVSPSATPQDIKRAYRKLALKYHPDVNK-EANAQEKFLKIKHAYTTLINSDSRRK 132

  Fly    88 YDKGIVHT----------AGAQYAQDVHDVAEPVVEDDAET--KFYK---SRFQKSRVSDSAGRT 137
            |......|          ..:|..:|.:.:.| .|.|...|  .|:|   ..::....|.|:...
plant   133 YGSDSRATGSSTGQTSRKGNSQVEEDFYGLGE-FVRDVQITVGDFFKDLQEEYKNWEASASSQGK 196

  Fly   138 P-----------------------IYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQ 179
            |                       |.|.|....:..|:.||..:.:..|..........|.|...
plant   197 PKSLWEELSEIGEEFVEFLEKELNISDEDNEGSSKNGERFDFEEGSTEKSSGKNNSSTKNSIEDN 261

  Fly   180 TDMV 183
            .|.:
plant   262 IDEI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 27/62 (44%)
DnaJ 27..89 CDD:278647 27/61 (44%)
AT5G59610NP_001330548.1 DnaJ 73..133 CDD:365959 27/60 (45%)
PRK14277 75..>222 CDD:184599 39/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.