DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AT5G49580

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001318769.1 Gene:AT5G49580 / 835020 AraportID:AT5G49580 Length:695 Species:Arabidopsis thaliana


Alignment Length:199 Identity:49/199 - (24%)
Similarity:78/199 - (39%) Gaps:55/199 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRR--QCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK 90
            ||.|||:.|  ......:|..|.|.:||.|||:|.|:|.||:.|:::..|||:|.:...::.||.
plant   409 HYSALGLARYGNVDMAYLKREYRKKAMLVHPDKNMGNERAAEAFKKLQNAYEVLLDSVKQKSYDD 473

  Fly    91 GIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYGKSFD 155
            .:..                     .|...|..|||.|...|:.|.       .:|.:.:|.|..
plant   474 ELKR---------------------EELLNYFRRFQNSSQKDTRGH-------GFSGSGFGSSEG 510

  Fly   156 RRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESSYDTPKQKAKERYRRDQE 220
            ..:.|..:..:|..::..|                   ::..||      |.|.|:..|:.:|.:
plant   511 EGEEAFRECRQIACKKCGN-------------------LHAWFL------TKKSKSTARWCQDCK 550

  Fly   221 EREQ 224
            |..|
plant   551 EFHQ 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 24/62 (39%)
DnaJ 27..89 CDD:278647 24/62 (39%)
AT5G49580NP_001318769.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.