DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AT5G18750

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_197376.1 Gene:AT5G18750 / 831993 AraportID:AT5G18750 Length:884 Species:Arabidopsis thaliana


Alignment Length:63 Identity:22/63 - (34%)
Similarity:36/63 - (57%) Gaps:5/63 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQ--GSENAAKKFREINQAYEILGNYRLRRLYD 89
            |..|.:.:...:|.||..|.||::..|||:|:  |:|:|   |:.|.:|..:|.:...||.:|
plant    68 YKILQVEQTADENTIKKQYKKLALHLHPDKNKLPGAESA---FKTIGEAQRVLLDKDKRRFHD 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 21/61 (34%)
DnaJ 27..89 CDD:278647 21/61 (34%)
AT5G18750NP_197376.1 DnaJ 66..127 CDD:395170 21/61 (34%)
DUF3444 392..605 CDD:403213
DUF3444 653..861 CDD:403213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.