DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11035 and AT5G18750

DIOPT Version :9

Sequence 1:	NP_001303469.1	Gene:	CG11035 / 40953	FlyBaseID:	FBgn0037544	Length:	231	Species:	Drosophila melanogaster
Sequence 2:	NP_197376.1	Gene:	AT5G18750 / 831993	AraportID:	AT5G18750	Length:	884	Species:	Arabidopsis thaliana

Alignment Length:	63	Identity:	22/63 - (34%)
Similarity:	36/63 - (57%)	Gaps:	5/63 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQ--GSENAAKKFREINQAYEILGNYRLRRLYD 89
            |..|.:.:...:|.||..|.||::..|||:|:  |:|:|   |:.|.:|..:|.:...||.:|
plant    68 YKILQVEQTADENTIKKQYKKLALHLHPDKNKLPGAESA---FKTIGEAQRVLLDKDKRRFHD 127

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11035	NP_001303469.1	DnaJ	26..>89	CDD:223560	21/61 (34%)
CG11035	NP_001303469.1	DnaJ	27..89	CDD:278647	21/61 (34%)
AT5G18750	NP_197376.1	DnaJ	66..127	CDD:395170	21/61 (34%)
		DUF3444	392..605	CDD:403213
		DUF3444	653..861	CDD:403213
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910