DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and ATJ6

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_196308.1 Gene:ATJ6 / 830582 AraportID:AT5G06910 Length:284 Species:Arabidopsis thaliana


Alignment Length:233 Identity:53/233 - (22%)
Similarity:104/233 - (44%) Gaps:48/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD 89
            :.|.|:.||:.|:.|..||:.||:||::..|||:||..:.|..||:::.:...|||:...|.:||
plant    27 ETSLYEVLGVERRATSQEIRKAYHKLALKLHPDKNQDDKEAKDKFQQLQKVISILGDEEKRAVYD 91

  Fly    90 K-GIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYGKS 153
            : |.:..|         |:.....|:..:  |::..::|  |:::       |.:|:..|:.|..
plant    92 QTGSIDDA---------DIPGDAFENLRD--FFRDMYKK--VNEA-------DIEEFEANYRGSE 136

  Fly   154 FDRRQAAQ------AKYDRI-------KVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESSYD 205
            .:::...:      .|.:|:       ..:.:::|.....|..:.|........|..:..:.|..
plant   137 SEKKDLLELFNKFKGKMNRLFCSMLCSDPKLDSHRFKDMLDEAIAAGEVKSSKAYEKWANKISET 201

  Fly   206 TP------KQKAKERYRRDQE--------EREQKLVGK 229
            .|      |:|.|:...:|.|        :|:::..||
plant   202 KPPTSPLRKRKKKKSAAKDSETDLCLMIAKRQEERKGK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 24/62 (39%)
DnaJ 27..89 CDD:278647 24/61 (39%)
ATJ6NP_196308.1 DnaJ 29..91 CDD:395170 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.