DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AT4G37480

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_195464.2 Gene:AT4G37480 / 829903 AraportID:AT4G37480 Length:531 Species:Arabidopsis thaliana


Alignment Length:290 Identity:63/290 - (21%)
Similarity:110/290 - (37%) Gaps:89/290 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YQHSPMLWRP----LLLLRGLYLSQRHQM---SHYDALGIRRQCTQNEIKAAYYKLSMLYHPD-- 57
            ::.|.:|:.|    ..||.|...|.|::.   :.||.|.:....:..||||::.:|:...|||  
plant    24 FEPSRILFNPSQGRTRLLSGEAESNRNEFPVENAYDILNVSETSSIAEIKASFRRLAKETHPDLI 88

  Fly    58 RNQGSENAAKKFREINQAYEILGNYRLRRLYDKGIV--------HTAGAQ--------------- 99
            .::...:.:::|.:|..|||||.:...|..||:.::        |:....               
plant    89 ESKKDPSNSRRFVQILAAYEILSDSEKRAHYDRYLLSRRMVMKKHSGQGYMIHRYKTGLTLSQEM 153

  Fly   100 --------YAQDVHDVAEPVVE----------DDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWS 146
                    |.:.:||:   |:|          |:.|..||           ||.|...:..|..|
plant   154 EVVEWLKWYREAIHDI---VLEKRVANGTGYLDELEEDFY-----------SAIRAAYFGPDVES 204

  Fly   147 RNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESS-------- 203
            .......|:..:  ::.||..:|   .:.:||:.       :|..|::...||..||        
plant   205 VELLPDCFEAEE--RSVYDTREV---LHLVSGRD-------LFGMVSLVDNFLELSSACSKKLAL 257

  Fly   204 ---YDTPKQKAKERYRRDQEEREQKLVGKQ 230
               .|:...:|.|:...|....|:  :|.|
plant   258 SSFMDSDLGQAVEKGNNDMMSAER--IGLQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 19/67 (28%)
DnaJ 27..89 CDD:278647 19/63 (30%)
AT4G37480NP_195464.2 DnaJ 7..86 CDD:413365 17/61 (28%)
DnaJ 56..120 CDD:395170 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.