DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and ATERDJ2B

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_567621.1 Gene:ATERDJ2B / 827866 AraportID:AT4G21180 Length:661 Species:Arabidopsis thaliana


Alignment Length:241 Identity:56/241 - (23%)
Similarity:99/241 - (41%) Gaps:60/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MLWRPLLLLRGLY----LSQRHQM-SHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAA 66
            :||..::.|  :|    :|:..|: ..:..||:....:.:|||.||.:||:.||||:|...| |.
plant    76 LLWIVMIFL--IYHTKNMSRESQLFEPFGILGLEPGASDSEIKKAYRRLSIQYHPDKNPDPE-AN 137

  Fly    67 KKFRE-INQAYEILGNYRLRRLYDKGIVHTAGAQ-YAQDVHDVAEPVVEDDAETKFYKSRFQKSR 129
            |.|.| |.:||:.|.:...|..::| ..|..|.| |..   .:|.|             :|..:.
plant   138 KYFVESIAKAYQALTDPLSRENFEK-YGHPDGRQGYTM---GIALP-------------QFILNM 185

  Fly   130 VSDSAG----------------RTPIYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRISG 178
            ..:|.|                ...||   .|..:.|..:..:.|..||.::.::.....:::  
plant   186 NGESGGILLLCTVGLCILLPLVIASIY---LWRSSKYTGNHVKLQTRQAYFELLQPSLTPSKV-- 245

  Fly   179 QTDMVLLAFIFAGVAV-----------YLMFLAESSYDTPKQKAKE 213
             .|:.:.|..:|.::|           ::...:|.:.|..|.|.:|
plant   246 -MDIFIRAAEYAEISVRKSDDESLQKLFMSVKSELNLDPKKLKQEE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 24/64 (38%)
DnaJ 27..89 CDD:278647 24/62 (39%)
ATERDJ2BNP_567621.1 DnaJ 99..161 CDD:278647 24/62 (39%)
SEC63 207..599 CDD:214744 16/90 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.