powered by:
Protein Alignment CG11035 and AT3G62190
DIOPT Version :9
Sequence 1: | NP_001303469.1 |
Gene: | CG11035 / 40953 |
FlyBaseID: | FBgn0037544 |
Length: | 231 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_191778.1 |
Gene: | AT3G62190 / 825392 |
AraportID: | AT3G62190 |
Length: | 138 |
Species: | Arabidopsis thaliana |
Alignment Length: | 56 |
Identity: | 18/56 - (32%) |
Similarity: | 29/56 - (51%) |
Gaps: | 4/56 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 NEIKAAYYKLSMLYHPDRNQGSEN--AAKKFREINQAYEIL--GNYRLRRLYDKGI 92
:::||||.|.....|||.....:. |..||:.|::||..| |:.:.:..|..|:
plant 21 SQVKAAYRKKVWESHPDLFPDDQKLVAESKFKSISEAYSCLESGDVKGQWYYRAGV 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.