DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AT3G57340

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_191293.1 Gene:AT3G57340 / 824901 AraportID:AT3G57340 Length:367 Species:Arabidopsis thaliana


Alignment Length:246 Identity:56/246 - (22%)
Similarity:98/246 - (39%) Gaps:81/246 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQ--GSENAAKKFREINQAYEILGNYRLR 85
            :.:..:|:.||:...|:.::::.||.|||:..|||:||  |||.|   |:.:::|::.|.|...|
plant   109 KSKKDYYEILGLESNCSVDDVRKAYRKLSLKVHPDKNQAPGSEEA---FKSVSKAFQCLSNDEAR 170

  Fly    86 RLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDF-DEWSRNH 149
            :.||     .:|:.         ||:             :|..|.:.|.|....|.: ||:..|.
plant   171 KKYD-----VSGSD---------EPI-------------YQPRRSARSNGFNGGYYYEDEFDPNE 208

  Fly   150 YGKSF-------------------------------DRRQAAQAKYD-RIKVQRETNRISGQTDM 182
            ..:||                               :..||..|.:: ||.:|     :.....:
plant   209 IFRSFFGGGGFGGGGMPPATAQFRSFNFGATRQRTANNNQAPDAGFNARILLQ-----LLPVVFI 268

  Fly   183 VLLAFIFAGVAVYLM---------FLAES--SYDTPKQKAKERYRRDQEER 222
            :||.|:.:...||.:         |..:.  :|.....|.::.|.||..:|
plant   269 LLLNFMPSSQPVYQLSATYPYQYKFTTQKGVNYFVKSSKFEQDYPRDSNDR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 23/64 (36%)
DnaJ 27..89 CDD:278647 23/63 (37%)
AT3G57340NP_191293.1 DnaJ 109..>210 CDD:223560 36/130 (28%)
DnaJ 113..174 CDD:278647 23/63 (37%)
DUF1977 277..361 CDD:286411 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.