powered by:
Protein Alignment CG11035 and AT3G17830
DIOPT Version :9
Sequence 1: | NP_001303469.1 |
Gene: | CG11035 / 40953 |
FlyBaseID: | FBgn0037544 |
Length: | 231 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_188410.2 |
Gene: | AT3G17830 / 821051 |
AraportID: | AT3G17830 |
Length: | 517 |
Species: | Arabidopsis thaliana |
Alignment Length: | 65 |
Identity: | 28/65 - (43%) |
Similarity: | 41/65 - (63%) |
Gaps: | 5/65 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPD--RNQGSENAAKKFREINQAYEILGNYRLRRLYDK 90
||..|.:.|..|..|||::|.||:..|||| :|.|:|: ||::|:.|||:|.:...|..||:
plant 64 HYSTLNVNRNATLQEIKSSYRKLARKYHPDMNKNPGAED---KFKQISAAYEVLSDEEKRSAYDR 125
Fly 91 90
plant 126 125
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.