DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AT3G14200

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_188036.1 Gene:AT3G14200 / 820637 AraportID:AT3G14200 Length:230 Species:Arabidopsis thaliana


Alignment Length:141 Identity:38/141 - (26%)
Similarity:66/141 - (46%) Gaps:28/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGS---ENAAKKFREINQAYEILGNY 82
            |::...:.|..||::::|::.|:::||.||::.:||||....   |.|.|||:.|.:||.:|.:.
plant     6 SEKINENLYAVLGLKKECSKTELRSAYKKLALRWHPDRCSSMEFVEEAKKKFQAIQEAYSVLSDS 70

  Fly    83 RLRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSR 147
            ..|.|||.|..:|........:.|....:.          :...:|:.||               
plant    71 NKRFLYDVGAYNTDDDDDQNGMGDFLNEMA----------TMMNQSKPSD--------------- 110

  Fly   148 NHYGKSFDRRQ 158
            |:.|.||::.|
plant   111 NNTGDSFEQLQ 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 24/65 (37%)
DnaJ 27..89 CDD:278647 24/64 (38%)
AT3G14200NP_188036.1 DnaJ 12..77 CDD:395170 24/64 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.