powered by:
Protein Alignment CG11035 and AT2G18465
DIOPT Version :9
Sequence 1: | NP_001303469.1 |
Gene: | CG11035 / 40953 |
FlyBaseID: | FBgn0037544 |
Length: | 231 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_849977.1 |
Gene: | AT2G18465 / 816361 |
AraportID: | AT2G18465 |
Length: | 268 |
Species: | Arabidopsis thaliana |
Alignment Length: | 41 |
Identity: | 13/41 - (31%) |
Similarity: | 25/41 - (60%) |
Gaps: | 2/41 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 NEIKAAYYKLSMLYHPDRNQGSENAA--KKFREINQAYEIL 79
:::|.|:...::.:|||::||....| :||:....||:.|
plant 223 DDVKNAFRSSALKWHPDKHQGPSQVAAQEKFKLCVDAYKSL 263
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.