DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AT2G18465

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_849977.1 Gene:AT2G18465 / 816361 AraportID:AT2G18465 Length:268 Species:Arabidopsis thaliana


Alignment Length:41 Identity:13/41 - (31%)
Similarity:25/41 - (60%) Gaps:2/41 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NEIKAAYYKLSMLYHPDRNQGSENAA--KKFREINQAYEIL 79
            :::|.|:...::.:|||::||....|  :||:....||:.|
plant   223 DDVKNAFRSSALKWHPDKHQGPSQVAAQEKFKLCVDAYKSL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 13/41 (32%)
DnaJ 27..89 CDD:278647 13/41 (32%)
AT2G18465NP_849977.1 DnaJ 211..264 CDD:197617 13/41 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.