DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and DNAJC5

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_079495.1 Gene:DNAJC5 / 80331 HGNCID:16235 Length:198 Species:Homo sapiens


Alignment Length:97 Identity:37/97 - (38%)
Similarity:52/97 - (53%) Gaps:9/97 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKG 91
            |.|..||:.:..|.::||.:|.||::.||||:|..:..||.||:|||.|:.||.:...|.:||| 
Human    15 SLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDK- 78

  Fly    92 IVHTAGAQYAQDVHDVAEPVVEDDAETKFYKS 123
                    |......|||...|::..|.|..|
Human    79 --------YGSLGLYVAEQFGEENVNTYFVLS 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 26/61 (43%)
DnaJ 27..89 CDD:278647 26/61 (43%)
DNAJC5NP_079495.1 DnaJ 15..>84 CDD:223560 30/77 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.