| Sequence 1: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_084322.2 | Gene: | Dnajc21 / 78244 | MGIID: | 1925371 | Length: | 531 | Species: | Mus musculus |
| Alignment Length: | 255 | Identity: | 66/255 - (25%) |
|---|---|---|---|
| Similarity: | 115/255 - (45%) | Gaps: | 65/255 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRN-QGSENAAKKFREINQAYEILGNYRLRRLYD-- 89
Fly 90 -----KG------------IVH----TAGAQYAQD------VHDVA---------EPVVEDDAET 118
Fly 119 KFYKSRFQKSRVSDSAGRTPIYDF-DEW-----SRN-HYGKSFDRRQAAQAKYDRIKVQRETNRI 176
Fly 177 -----SGQTDMV--LLAFI---FAGVAVYLMFLAESSYDTPKQKAKERYRRDQEEREQKL 226 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 25/61 (41%) |
| DnaJ | 27..89 | CDD:278647 | 25/61 (41%) | ||
| Dnajc21 | NP_084322.2 | DnaJ | 3..66 | CDD:278647 | 25/61 (41%) |
| DBINO | <181..243 | CDD:290603 | 13/63 (21%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 278..309 | ||||
| zf-C2H2_jaz | 314..339 | CDD:288983 | |||
| C2H2 Zn finger | 316..338 | CDD:275371 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 327..480 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 507..531 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||