DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajc18

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_083945.1 Gene:Dnajc18 / 76594 MGIID:1923844 Length:357 Species:Mus musculus


Alignment Length:162 Identity:38/162 - (23%)
Similarity:66/162 - (40%) Gaps:38/162 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEIL 79
            |||:...::.: ::||.||:....:..|:|.||.||::.:|||:| .:..|.:.|:.|..|:.:|
Mouse    71 LRGVQRIKKCR-NYYDILGVSHNASDEELKKAYKKLALKFHPDKN-CAPGATEAFKAIGNAFAVL 133

  Fly    80 GNYRLRRLYDK--------GIVHTAGAQYAQDVHDVAEPV---------------------VEDD 115
            .|...|..||:        .:.......|.:|......|.                     |.||
Mouse   134 SNPDKRLRYDEYGDEQVTFTVPRARSYHYYKDFEADISPEELFNVFFGGHFPSGNIHMFSNVTDD 198

  Fly   116 AETKFYKSRFQKSRV-----SDSAGRTPIYDF 142
            ::  :|:.|.:..|.     .:...:||...|
Mouse   199 SQ--YYRRRHRHERTQTHKREEDKSQTPYSAF 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 21/62 (34%)
DnaJ 27..89 CDD:278647 21/61 (34%)
Dnajc18NP_083945.1 PRK14298 81..>182 CDD:184612 26/102 (25%)
DUF1977 250..349 CDD:370429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.