DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajc14

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001346753.1 Gene:Dnajc14 / 74330 MGIID:1921580 Length:703 Species:Mus musculus


Alignment Length:193 Identity:41/193 - (21%)
Similarity:83/193 - (43%) Gaps:36/193 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAY 76
            ||.:.|:   ...:::.:..||:....:..|:|.||.:|:::.|||:|. ...|.:.|:.:..|:
Mouse   432 LLTMAGV---PEDELNPFHVLGVEATASDTELKKAYRQLAVMVHPDKNH-HPRAEEAFKILRAAW 492

  Fly    77 EILGNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAET--------------KFYKSRFQK 127
            :|:.|...|:.|:  :...|..:.::.|::....:.:|..|.              :|...|..|
Mouse   493 DIVSNPERRKEYE--MKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSRCQGKHRRFEMDREPK 555

  Fly   128 S-RVSDSAGRT-PIYDFDEWSRNHY------------GKSFDRRQAAQAKYDRIKVQRETNRI 176
            | |......|. |..:.|.|:.:..            ||.:|..:.|..:  |:.:..:|:|:
Mouse   556 SARYCAECNRLHPAEEGDFWAESSMLGLKITYFALMDGKVYDITEWAGCQ--RVGISPDTHRV 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 17/62 (27%)
DnaJ 27..89 CDD:278647 17/61 (28%)
Dnajc14NP_001346753.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..229
DnaJ 444..505 CDD:365959 17/61 (28%)
Jiv90 533..621 CDD:373372 16/86 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 622..643
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 659..703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.