DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and ranbp9

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001037977.1 Gene:ranbp9 / 733762 XenbaseID:XB-GENE-494852 Length:548 Species:Xenopus tropicalis


Alignment Length:110 Identity:23/110 - (20%)
Similarity:42/110 - (38%) Gaps:35/110 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 VSDSAGRTP-IYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNR--ISGQTDMVLLAFIFAG 191
            |..:.|::| ::|.:::.|..                |.|:|.:..|  :.|:...::...:.: 
 Frog   180 VDANFGQSPFVFDIEDYIREW----------------RTKIQAQIERFPVGGEWQSMIQRMVSS- 227

  Fly   192 VAVYLMFLAESSY-DTPKQKAKERYRRDQEE--------REQKLV 227
                  :|....| .|.:..||...:..|||        |.||||
 Frog   228 ------YLVHHGYCSTAEAFAKSTDQTVQEELASIKNRQRIQKLV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560
DnaJ 27..89 CDD:278647
ranbp9NP_001037977.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
SPRY_RanBP9_10 44..186 CDD:293966 1/5 (20%)
LisH 216..249 CDD:128913 5/39 (13%)
CLTH 255..527 CDD:371161 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.