DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajb14

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001028327.1 Gene:Dnajb14 / 70604 MGIID:1917854 Length:379 Species:Mus musculus


Alignment Length:252 Identity:53/252 - (21%)
Similarity:87/252 - (34%) Gaps:73/252 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD-- 89
            ::|:.||:.:.....::|.||.||::.:|||:|. :..|...|::|..||.:|.|...|:.||  
Mouse   108 NYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKNH-APGATDAFKKIGNAYAVLSNPEKRKQYDLT 171

  Fly    90 ----KGIVHTAGAQYAQDVHDVAE-PVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNH 149
                :...|....::  :.|...| .:..:|....|:...|....|...:.....|......| |
Mouse   172 GSEEQACNHQNNGRF--NFHRGCEADITPEDLFNIFFGGGFPSGSVHSFSNGRAAYSHQHQHR-H 233

  Fly   150 YGKSFDRRQA------------------------------AQAKYDR------IKVQRETNRISG 178
            .|...:..:|                              ..:.|.|      ||:|.|.     
Mouse   234 SGHEREEERADGGFSVFIQLMPIIVLILVSLLSQLMVSNPPYSLYPRSGSGQTIKMQTEN----- 293

  Fly   179 QTDMVLLAFIFAGVAVYLMFLAESSY-DTPKQKAKERYRRDQ---------EEREQK 225
                       .||..|:....:|.| .|..||.::....|.         :||:||
Mouse   294 -----------LGVVYYVSKDFKSEYKGTLLQKVEKSVEEDYVTNIRNNCWKERQQK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 20/61 (33%)
DnaJ 27..89 CDD:278647 20/61 (33%)
Dnajb14NP_001028327.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..90
DnaJ 107..>214 CDD:223560 28/108 (26%)
DnaJ 108..169 CDD:278647 20/61 (33%)
DUF1977 271..371 CDD:286411 19/85 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.