Sequence 1: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001028327.1 | Gene: | Dnajb14 / 70604 | MGIID: | 1917854 | Length: | 379 | Species: | Mus musculus |
Alignment Length: | 252 | Identity: | 53/252 - (21%) |
---|---|---|---|
Similarity: | 87/252 - (34%) | Gaps: | 73/252 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 SHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD-- 89
Fly 90 ----KGIVHTAGAQYAQDVHDVAE-PVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNH 149
Fly 150 YGKSFDRRQA------------------------------AQAKYDR------IKVQRETNRISG 178
Fly 179 QTDMVLLAFIFAGVAVYLMFLAESSY-DTPKQKAKERYRRDQ---------EEREQK 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 20/61 (33%) |
DnaJ | 27..89 | CDD:278647 | 20/61 (33%) | ||
Dnajb14 | NP_001028327.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 56..90 | ||
DnaJ | 107..>214 | CDD:223560 | 28/108 (26%) | ||
DnaJ | 108..169 | CDD:278647 | 20/61 (33%) | ||
DUF1977 | 271..371 | CDD:286411 | 19/85 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |