DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajc30

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_079638.2 Gene:Dnajc30 / 66114 MGIID:1913364 Length:219 Species:Mus musculus


Alignment Length:219 Identity:72/219 - (32%)
Similarity:108/219 - (49%) Gaps:40/219 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SPMLWR-------PLLLLRGLYLSQR--HQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQ 60
            || |||       |.....||....|  .:.:.|:.||:....||.:||||||:.|.|||||||.
Mouse    12 SP-LWRWWQVRGLPPSSATGLCSRGRTYSRTALYELLGVPSTATQAQIKAAYYRQSFLYHPDRNP 75

  Fly    61 GSENAAKKFREINQAYEILGNYRLRRLYDKGIVHTAGAQYAQDVH---------DVAEPVVEDDA 116
            ||..||::|..:::||.:||:..|||.||:|::..      ||:.         .||:|.   ..
Mouse    76 GSAEAAERFTRVSEAYLVLGSTILRRKYDRGLLSD------QDLRGPGVKPSKTPVADPA---PP 131

  Fly   117 ETKFYKSRFQ-KSRVSDSAGRTPIYDFDEWSRNHYGKSFDRRQAAQAKYD--RIKVQRETNRISG 178
            ....|..|.. .||.|...||| ::|||.:.:.|||:..:|.:..:|:.:  |.|.:.:.|:.:.
Mouse   132 RPPPYTPRAPGGSRASPGDGRT-MFDFDAFYQAHYGEQLERERRLRARREALRKKQENQANKGTS 195

  Fly   179 QTD--------MVLLAFIFAGVAV 194
            ..|        ::.|.|:|.|..:
Mouse   196 WDDTRDATFFVVLFLIFVFVGFRI 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 31/62 (50%)
DnaJ 27..89 CDD:278647 31/61 (51%)
Dnajc30NP_079638.2 DnaJ 43..104 CDD:278647 31/60 (52%)
DnaJ 44..>105 CDD:223560 32/60 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..148 9/47 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9250
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I5050
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51945
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007820
OrthoInspector 1 1.000 - - oto92419
orthoMCL 1 0.900 - - OOG6_105154
Panther 1 1.100 - - LDO PTHR44873
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5453
SonicParanoid 1 1.000 - - X4983
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.