DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11035 and DNAJC1

DIOPT Version :9

Sequence 1:	NP_001303469.1	Gene:	CG11035 / 40953	FlyBaseID:	FBgn0037544	Length:	231	Species:	Drosophila melanogaster
Sequence 2:	NP_071760.2	Gene:	DNAJC1 / 64215	HGNCID:	20090	Length:	554	Species:	Homo sapiens

Alignment Length:	137	Identity:	43/137 - (31%)
Similarity:	70/137 - (51%)	Gaps:	31/137 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly     5 SPMLWRPLLLL------RG-------LY-LSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYH 55
            :|:||..||||      ||       |: |.:..|::.|..||:::..:..:|:.||.|||:..|
Human    29 TPLLWLLLLLLAAVAPARGWESGDLELFDLVEEVQLNFYQFLGVQQDASSADIRKAYRKLSLTLH 93

  Fly    56 PDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKF 120
            ||:|: .|||..:||::...||:|.:...|:.||..:::        .:.|..:||        |
Human    94 PDKNK-DENAETQFRQLVAIYEVLKDDERRQRYDDILIN--------GLPDWRQPV--------F 141

  Fly   121 YKSRFQK 127
            |..|.:|
Human   142 YYRRVRK 148

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11035	NP_001303469.1	DnaJ	26..>89	CDD:223560	22/62 (35%)
CG11035	NP_001303469.1	DnaJ	27..89	CDD:278647	22/61 (36%)
DNAJC1	NP_071760.2	DnaJ	65..126	CDD:278647	22/61 (36%)
		SANT	329..375	CDD:238096
		SANT	495..544	CDD:197842
		SANT	496..543	CDD:238096
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910