DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and zgc:122979

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001032663.2 Gene:zgc:122979 / 641576 ZFINID:ZDB-GENE-051127-45 Length:360 Species:Danio rerio


Alignment Length:180 Identity:46/180 - (25%)
Similarity:77/180 - (42%) Gaps:41/180 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK 90
            :.:|..||:.....:.||:.||.:|::.||||:|..:: |..||::|.|||::|.:...|.:||:
Zfish    50 VDYYSVLGVSNDSNEEEIRKAYKRLALRYHPDKNSDAD-AEDKFKQIAQAYDVLTDPEKRNIYDQ 113

  Fly    91 ------GIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYD-FDEWSRN 148
                  |:..|.         :..:|.....|:...:...|.....||.       | |:.::||
Zfish   114 QGLTKGGVAPTC---------NKTDPSHNSKADAHSWHMFFNFDLDSDD-------DLFNPFTRN 162

  Fly   149 -------HYGKSFDRRQAAQAKYDRIKVQRE------TNRIS----GQTD 181
                   |:|.....:.|..|:...:.|..|      |.|:.    .|||
Zfish   163 PLPHLSRHHGNKGGLKPAGDAEVHDLSVSLEDILMGVTKRVKLTRLRQTD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 22/62 (35%)
DnaJ 27..89 CDD:278647 22/61 (36%)
zgc:122979NP_001032663.2 DnaJ 50..355 CDD:223560 46/180 (26%)
DnaJ 51..112 CDD:278647 22/61 (36%)
DnaJ_C 185..345 CDD:199909 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.