DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajc3b

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_571705.1 Gene:dnajc3b / 58154 ZFINID:ZDB-GENE-000831-4 Length:502 Species:Danio rerio


Alignment Length:82 Identity:27/82 - (32%)
Similarity:42/82 - (51%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LSQRHQM-------SHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQG---SENAAKKFREINQ 74
            |.:.|::       .:|..||:.|...:.||..||.||:..:|||..|.   .:.|.|||.:|..
Zfish   382 LDRAHKLLKISRKRDYYKILGVSRSANKQEIIKAYRKLAQQWHPDNFQSEADKKEAEKKFIDIAS 446

  Fly    75 AYEILGNYRLRRLYDKG 91
            |.|:|.:..:|:.:|.|
Zfish   447 AKEVLTDPEMRQKFDSG 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 23/72 (32%)
DnaJ 27..89 CDD:278647 23/64 (36%)
dnajc3bNP_571705.1 TPR_11 41..107 CDD:290150
TPR repeat 42..70 CDD:276809
TPR repeat 75..105 CDD:276809
TPR_11 77..141 CDD:290150
TPR repeat 110..137 CDD:276809
TPR repeat 157..184 CDD:276809
TPR_11 189..254 CDD:290150
TPR repeat 190..218 CDD:276809
TPR repeat 223..253 CDD:276809
TPR repeat 303..337 CDD:276809
TPR repeat 342..370 CDD:276809
TPR 348..375 CDD:197478
DnaJ 394..>500 CDD:223560 25/70 (36%)
DnaJ 396..461 CDD:278647 23/64 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.