DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajc4

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001343928.1 Gene:Dnajc4 / 57431 MGIID:1927346 Length:261 Species:Mus musculus


Alignment Length:248 Identity:61/248 - (24%)
Similarity:97/248 - (39%) Gaps:70/248 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWRPLLLLRGLYLS--QRH-QMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKF 69
            ||...|.:|.|..:  ||. ..::|:.||:....:..|||.|::..|...||||:.|:.....:|
Mouse    31 LWPHSLSIRLLTAATGQRSVPTNYYELLGVHPGASAEEIKRAFFTKSKELHPDRDPGNPALHSRF 95

  Fly    70 REINQAYEILGNYRLRRLYD---------KGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRF 125
            .|:|:||.:|.....||.||         |....||..:|.|..|                    
Mouse    96 VELNEAYRVLSREESRRNYDHQLHSASPPKSSGSTAEPKYTQQTH-------------------- 140

  Fly   126 QKSRVSDSAGRTPIYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETN-RISGQTDMVLLAFIF 189
                  .|:...|...:  |::.|    ..|.|..:::    |.||:.| |:.|    ..|..:.
Mouse   141 ------SSSWEPPNAQY--WAQFH----SVRPQGPESR----KQQRKHNQRVLG----YCLLLMV 185

  Fly   190 AGVA-----------VYLMFLAESS------YDTPKQKAKERYRRDQEEREQK 225
            ||:.           |:..|:.|..      |:..:.:|:....|.|:||:|:
Mouse   186 AGMGLHYVAFRKLEQVHRSFMDEKDRIITAIYNDTRARARANRARIQQERQQR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 21/62 (34%)
DnaJ 27..89 CDD:278647 21/61 (34%)
Dnajc4NP_001343928.1 DnaJ 53..115 CDD:395170 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.