DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajb5

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001093510.1 Gene:dnajb5 / 569466 ZFINID:ZDB-GENE-070705-308 Length:360 Species:Danio rerio


Alignment Length:76 Identity:30/76 - (39%)
Similarity:47/76 - (61%) Gaps:10/76 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGI 92
            :|..|||.....::|||.||.|:::.:|||:|: ..||.:||:||.:|||:|.:.:.|.:||   
Zfish     5 YYKILGIPSGSNEDEIKKAYRKMALKFHPDKNK-DPNAEEKFKEIAEAYEVLSDPKKRVIYD--- 65

  Fly    93 VHTAGAQYAQD 103
                  ||.:|
Zfish    66 ------QYGED 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 25/60 (42%)
DnaJ 27..89 CDD:278647 25/60 (42%)
dnajb5NP_001093510.1 DnaJ 1..355 CDD:223560 30/76 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.