DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajc30b

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001313323.1 Gene:dnajc30b / 565734 ZFINID:ZDB-GENE-131121-532 Length:269 Species:Danio rerio


Alignment Length:229 Identity:66/229 - (28%)
Similarity:108/229 - (47%) Gaps:56/229 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYQHSPMLWRP--------------LLLLR----GLY----------LSQRHQMSHYDALGIRRQ 37
            ::.....|:||              .||||    .||          |..|.:.::||.|.:...
Zfish    57 LHNKHAQLYRPQISGCYTLVSAKHWCLLLRPVGSRLYSCRTADESSGLLHRSRTAYYDILKVSPN 121

  Fly    38 CTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGIVHTAGAQYAQ 102
            .|..:||:||||.|.:||||||: ||:||::|..:.:||.:||:..|||.||:||:      ..:
Zfish   122 ATHAQIKSAYYKQSFIYHPDRNR-SEDAARQFALVAEAYNVLGSSSLRRRYDRGIL------TQK 179

  Fly   103 DVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYGKSFDRR-----QAAQA 162
            :|.....|...            ...|.:.::|:|..:|||.:.:.|||:...|.     :..|.
Zfish   180 EVQSSGRPAAP------------PPPRRAPASGKTAHFDFDAFYQAHYGEQLQREKLQRLRQQQI 232

  Fly   163 KYDRIKVQRETNR--ISGQTDMVLLAFIFAGVAV 194
            :..|:::|::..|  |:|.:  |:|..:..||.:
Zfish   233 QQRRMEMQKQWRREQITGVS--VILLLLLGGVII 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 29/62 (47%)
DnaJ 27..89 CDD:278647 29/61 (48%)
dnajc30bNP_001313323.1 DnaJ 112..172 CDD:278647 29/60 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9947
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404041at2759
OrthoFinder 1 1.000 - - FOG0007820
OrthoInspector 1 1.000 - - oto40686
orthoMCL 1 0.900 - - OOG6_105154
Panther 1 1.100 - - LDO PTHR44873
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5453
SonicParanoid 1 1.000 - - X4983
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.