DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajc18

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001107060.1 Gene:dnajc18 / 559928 ZFINID:ZDB-GENE-030131-8019 Length:407 Species:Danio rerio


Alignment Length:189 Identity:45/189 - (23%)
Similarity:76/189 - (40%) Gaps:34/189 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLY----D 89
            |:.||:.:..:..::|.||.||::.:|||:| .:..|...|:.|..||.:|.|...|:.|    |
Zfish   123 YEILGVPKGASDEDLKKAYRKLALRFHPDKN-CAPGATDAFKAIGNAYAVLSNPEKRQQYDEYGD 186

  Fly    90 KGIVHTAGAQYAQD----------VHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDE 144
            :|...|:....||.          ..|....:..::....|:..||       ..|...:|....
Zfish   187 QGPAETSSQPSAQPRQAYARHRSFTRDFEPDISPEELFNIFFGGRF-------PTGNIHVYTNGG 244

  Fly   145 WSRNHY-----GKSFDRRQAAQAKYDRIKVQRETNRISGQTDMV-LLAFIFAGVAVYLM 197
            .|..||     .:.|:||:      :.::....||..:....:: :|..|...|...||
Zfish   245 ASYAHYYQPRRRRPFERRE------EEVEESHSTNNFTPLLQLLPVLVLIVISVFTQLM 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 21/63 (33%)
DnaJ 27..89 CDD:278647 21/63 (33%)
dnajc18NP_001107060.1 DnaJ 121..182 CDD:278647 20/59 (34%)
DUF1977 299..399 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.