DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and DNAJA4

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_061072.3 Gene:DNAJA4 / 55466 HGNCID:14885 Length:426 Species:Homo sapiens


Alignment Length:73 Identity:31/73 - (42%)
Similarity:48/73 - (65%) Gaps:7/73 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RHQM----SHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYR 83
            ||:|    .:||.||::...:..|||.||.||::.||||:|   .:..:||:.|:||||:|.:.:
Human    27 RHKMVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKN---PDEGEKFKLISQAYEVLSDPK 88

  Fly    84 LRRLYDKG 91
            .|.:||:|
Human    89 KRDVYDQG 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 26/66 (39%)
DnaJ 27..89 CDD:278647 25/61 (41%)
DNAJA4NP_061072.3 PTZ00037 15..423 CDD:240236 31/73 (42%)
DnaJ 36..94 CDD:278647 25/60 (42%)
DnaJ_C 135..361 CDD:199909
DnaJ_zf 164..230 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.