Sequence 1: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001019564.1 | Gene: | dnajb9b / 554091 | ZFINID: | ZDB-GENE-050522-76 | Length: | 199 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 48/199 - (24%) |
---|---|---|---|
Similarity: | 84/199 - (42%) | Gaps: | 44/199 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 LLLLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAY 76
Fly 77 EILGNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVED-------DAETKFYKSRFQKSRVSDSA 134
Fly 135 GRTPIYDFDEWSRNHYGKSF----------------------DRRQAAQAKYDRIKVQRETNRIS 177
Fly 178 GQTD 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 25/62 (40%) |
DnaJ | 27..89 | CDD:278647 | 25/61 (41%) | ||
dnajb9b | NP_001019564.1 | DnaJ | 26..87 | CDD:278647 | 25/61 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |