DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajc1

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001071003.1 Gene:dnajc1 / 553324 ZFINID:ZDB-GENE-061103-529 Length:526 Species:Danio rerio


Alignment Length:236 Identity:54/236 - (22%)
Similarity:100/236 - (42%) Gaps:68/236 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGIV 93
            |:.|.:.:..:.:||:.||.|||::.|||:|: .|||..:||::...||:|.:...|:.||..:|
Zfish    44 YEFLSVNQDASSSEIRKAYRKLSLILHPDKNK-DENAENQFRQLVAIYEVLKDEERRQRYDDILV 107

  Fly    94 HTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYG------- 151
            :        .:.|..:||        ||..|.:|.    |.|......|...:..||.       
Zfish   108 N--------GLPDWRQPV--------FYYRRVRKM----SNGELGFLLFLILTVGHYAVIWSIYL 152

  Fly   152 -KSFDRRQAAQAKYDRIKVQRETNRISGQT-----------------DMVLLAFIFAGVAVYLMF 198
             |..|.   ..::..|.|.:::|::::.:.                 |::.|.     ::::|.:
Zfish   153 EKQLDE---LLSRKKREKKKKQTSKMTDEMKPLAQDKNERSDRPHWHDILPLK-----LSIWLYY 209

  Fly   199 LAES---------SY--DTPKQKAKERYRRD---QEEREQK 225
            ..:|         .|  |..:.|.||:...:   ::|.:||
Zfish   210 SIKSLPHIIQDVKQYYKDYKEMKVKEKEEAEALAEQEMQQK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 22/59 (37%)
DnaJ 27..89 CDD:278647 22/59 (37%)
dnajc1NP_001071003.1 DnaJ 42..103 CDD:278647 22/59 (37%)
SANT 307..353 CDD:238096
SANT 469..514 CDD:238096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.