DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajb14

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001016588.1 Gene:dnajb14 / 549342 XenbaseID:XB-GENE-952313 Length:375 Species:Xenopus tropicalis


Alignment Length:139 Identity:33/139 - (23%)
Similarity:58/139 - (41%) Gaps:17/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKG 91
            ::|:.||:.....:.::|.||.||::.:|||:|. :..|.:.|::|..||.:|.|...|:.||. 
 Frog   106 TYYEVLGVSTDAGEEDLKKAYRKLALKFHPDKNH-APGATEAFKKIGNAYAVLSNPEKRKQYDL- 168

  Fly    92 IVHTAGAQYAQDVH---------DVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSR 147
               |......|:.|         .....:..:|....|:...|....|...:.....|...:   
 Frog   169 ---TGSEDQMQNNHRNGGFDYHRGFEADITPEDLFNMFFGGGFPSGSVHTFSNGRARYSHHQ--- 227

  Fly   148 NHYGKSFDR 156
            :|:....||
 Frog   228 HHHHSGHDR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 20/61 (33%)
DnaJ 27..89 CDD:278647 20/61 (33%)
dnajb14NP_001016588.1 FliS 6..>34 CDD:382133
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..95
DnaJ_bact 107..>212 CDD:274090 28/109 (26%)
DUF1977 269..367 CDD:370429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.