DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajb2

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_012825839.2 Gene:dnajb2 / 548454 XenbaseID:XB-GENE-951530 Length:361 Species:Xenopus tropicalis


Alignment Length:267 Identity:61/267 - (22%)
Similarity:102/267 - (38%) Gaps:74/267 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRN-QGSENAAKKFREINQAYEILGN-------- 81
            :.:||.||:.|..:|::||.||.||::.:|||:| ...|:|.:||::|.:|||:|.:        
 Frog     2 VDYYDILGVPRNASQDDIKRAYRKLALRWHPDKNPDNKEHAERKFKDIAEAYEVLSDGEKREAYD 66

  Fly    82 --------------YRLRRLYDKGIVHTAGAQYAQDVHDVAEP---VVEDDAETKFYKSRFQKSR 129
                          .|::|.:|.|....:.....:|.....:|   ::.||.    :........
 Frog    67 NMTSGFSDPGAFRATRVQRPFDFGFQFRSPEDVFRDFFGGKDPFPHMIGDDV----FMFPNHPHG 127

  Fly   130 VSDSAGRTPIYDFDEWSRNHYGKSFDRRQ------------AAQAKY---DRIKVQR----ETNR 175
            |:..|...|::.    |..|:|..|....            :...|:   .||..:|    :..|
 Frog   128 VTHHANSVPMFP----SSFHFGNEFSFHSGGLGGSRNFCSVSTSTKFVNGKRITTKRIMENDVER 188

  Fly   176 ISGQTDMVLLAFIFAGVAVYLMFLAESS-------------YDTPKQKAKER--------YRRDQ 219
            |..:.|..|.:.:..||...|....|.|             .|.|....::|        ..||.
 Frog   189 IEVEEDGELKSILVNGVEDDLALAVELSKREQASVPRASARTDGPSYNIQQRSPPGTPVVQDRDD 253

  Fly   220 EEREQKL 226
            |:.|.:|
 Frog   254 EDEELQL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 27/85 (32%)
DnaJ 27..89 CDD:278647 27/84 (32%)
dnajb2XP_012825839.2 PRK10767 3..>106 CDD:236757 30/102 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.