DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11035 and DNAJC10

DIOPT Version :9

Sequence 1:	NP_001303469.1	Gene:	CG11035 / 40953	FlyBaseID:	FBgn0037544	Length:	231	Species:	Drosophila melanogaster
Sequence 2:	NP_061854.1	Gene:	DNAJC10 / 54431	HGNCID:	24637	Length:	793	Species:	Homo sapiens

Alignment Length:	94	Identity:	33/94 - (35%)
Similarity:	53/94 - (56%)	Gaps:	5/94 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD---- 89
            |..||:.:..:..||:.|:.||::..|||:|..:.||...|.:||:|||:|.:..||:.||
Human    37 YSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGE 101

  Fly    90 KGIVHTAGAQY-AQDVHDVAEPVVEDDAE 117
            ||:....|.|| :.:.:.....:.:||.|
Human   102 KGLEDNQGGQYESWNYYRYDFGIYDDDPE 130

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11035	NP_001303469.1	DnaJ	26..>89	CDD:223560	23/59 (39%)
CG11035	NP_001303469.1	DnaJ	27..89	CDD:278647	23/59 (39%)
DNAJC10	NP_061854.1	DnaJ	34..>132	CDD:223560	33/94 (35%)
		PDI_a_ERdj5_N	129..229	CDD:239301	1/2 (50%)
		Trxb 1	235..350
		Trxb 2	348..463
		PDI_a_ERdj5_C	453..550	CDD:239302
		PDI_a_ERdj5_C	556..663	CDD:239302
		PDI_a_ERdj5_C	670..775	CDD:239302
		Prevents secretion from ER. /evidence=ECO:0000255\|PROSITE-ProRule:PRU10138	790..793
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910