DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AgaP_AGAP001859

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_001238449.2 Gene:AgaP_AGAP001859 / 4577058 VectorBaseID:AGAP001859 Length:385 Species:Anopheles gambiae


Alignment Length:201 Identity:42/201 - (20%)
Similarity:79/201 - (39%) Gaps:42/201 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD---- 89
            |:.||:.::.|.:|||..|.|.::..|||:|: :..|.:.|:.:..|.|.|.:.:.|:.||    
Mosquito   116 YEVLGVTQEATDSEIKKCYKKHALQLHPDKNK-APGAMEAFKSLGNAVETLTDPQKRKAYDLYRT 179

  Fly    90 --------KGIVHTAGAQYAQD----VHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDF 142
                    :......|..|.|:    ..|....:..:|....|:...|.:.:             
Mosquito   180 TGGGPAGTRARASNGGYTYGQNGFNFQSDFDTGINPNDLFNMFFGGGFPQQQ------------- 231

  Fly   143 DEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVL-LAFIFAGVAVYLMFLAESSYDT 206
            .:.:::||   :..|....::||        :|...|..::. |...|..|::...|.|.....:
Mosquito   232 QQHTQHHY---YRARAGRGSQYD--------DRNVSQPSLIFGLILCFVVVSLLSTFFASDPVYS 285

  Fly   207 PKQKAK 212
            .:|..|
Mosquito   286 LQQTGK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 19/59 (32%)
DnaJ 27..89 CDD:278647 19/59 (32%)
AgaP_AGAP001859XP_001238449.2 DnaJ 113..>221 CDD:223560 26/105 (25%)
DnaJ 114..175 CDD:278647 19/59 (32%)
DUF1977 280..377 CDD:286411 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.