DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnaja2

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001004807.1 Gene:dnaja2 / 448048 XenbaseID:XB-GENE-998337 Length:410 Species:Xenopus tropicalis


Alignment Length:80 Identity:33/80 - (41%)
Similarity:47/80 - (58%) Gaps:7/80 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK--- 90
            ||.||:....::|::|.||.||:..||||:|   .||..||:||:.|||:|.|...|.|||:   
 Frog    10 YDILGVAPGASENDLKKAYRKLAKEYHPDKN---PNAGDKFKEISFAYEVLSNPEKRELYDRYGE 71

  Fly    91 -GIVHTAGAQYAQDV 104
             |:...:|.....|:
 Frog    72 QGLREGSGGSGMDDI 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 28/59 (47%)
DnaJ 27..89 CDD:278647 28/59 (47%)
dnaja2NP_001004807.1 PTZ00037 4..410 CDD:240236 33/80 (41%)
DnaJ 9..67 CDD:278647 28/59 (47%)
DnaJ_C 113..339 CDD:199909
DnaJ_zf 142..208 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.