DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajb4

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001003455.1 Gene:dnajb4 / 445061 ZFINID:ZDB-GENE-040801-192 Length:340 Species:Danio rerio


Alignment Length:262 Identity:61/262 - (23%)
Similarity:98/262 - (37%) Gaps:88/262 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD--- 89
            :|..|||.:..:.::||.||.|.::.:|||:|:.: ||.:||:|:.:|||:|.:.:.|.:||   
Zfish     5 YYKILGITKGASDDDIKKAYRKQALKWHPDKNKAA-NAEEKFKEVAEAYEVLSDPKKREIYDQYG 68

  Fly    90 -KGIVHTAGAQ----------YAQDVHDV-------AEPVV-----------EDDAETKFYKSRF 125
             :|:....||.          :..|.|..       |.|..           |||.|..      
Zfish    69 EEGLKGGGGASDGPGGNFTYTFHGDPHATFATFFGGASPFEVFFGRKVNGRDEDDMEVD------ 127

  Fly   126 QKSRVSDSAGRTPIYDFDEWSRN------HYGKSFD--RRQAAQAKYD--------------RIK 168
                     |..|...|..::.|      |.|:...  |:|.....::              |:|
Zfish   128 ---------GNDPFGSFTSFNINGFPRERHVGQGGPPRRKQDPAIHHELRVSLEEVFHGSTKRMK 183

  Fly   169 VQRETNRISGQT----DMVLLAFIFAG--VAVYLMFLAESSYDTP-----------KQKAKERYR 216
            :.|:.....|:|    |.:|...|..|  ....:.|..|.. :||           |.|....:|
Zfish   184 ISRKRLNPDGRTLRTEDKILTIEIKRGWKEGTKITFPREGD-ETPNTIPADIVFVIKDKPHGHFR 247

  Fly   217 RD 218
            |:
Zfish   248 RE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 23/60 (38%)
DnaJ 27..89 CDD:278647 23/60 (38%)
dnajb4NP_001003455.1 DnaJ 1..334 CDD:223560 61/262 (23%)
DnaJ 4..65 CDD:278647 23/60 (38%)
DnaJ_C 163..325 CDD:199909 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.