Sequence 1: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001003455.1 | Gene: | dnajb4 / 445061 | ZFINID: | ZDB-GENE-040801-192 | Length: | 340 | Species: | Danio rerio |
Alignment Length: | 262 | Identity: | 61/262 - (23%) |
---|---|---|---|
Similarity: | 98/262 - (37%) | Gaps: | 88/262 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD--- 89
Fly 90 -KGIVHTAGAQ----------YAQDVHDV-------AEPVV-----------EDDAETKFYKSRF 125
Fly 126 QKSRVSDSAGRTPIYDFDEWSRN------HYGKSFD--RRQAAQAKYD--------------RIK 168
Fly 169 VQRETNRISGQT----DMVLLAFIFAG--VAVYLMFLAESSYDTP-----------KQKAKERYR 216
Fly 217 RD 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 23/60 (38%) |
DnaJ | 27..89 | CDD:278647 | 23/60 (38%) | ||
dnajb4 | NP_001003455.1 | DnaJ | 1..334 | CDD:223560 | 61/262 (23%) |
DnaJ | 4..65 | CDD:278647 | 23/60 (38%) | ||
DnaJ_C | 163..325 | CDD:199909 | 17/88 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |