DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and DNAJB9

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_036460.1 Gene:DNAJB9 / 4189 HGNCID:6968 Length:223 Species:Homo sapiens


Alignment Length:213 Identity:54/213 - (25%)
Similarity:94/213 - (44%) Gaps:50/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAY 76
            :|::..|.|:.:   |:||.||:.:..::.:||.|::||:|.||||:|: |.:|..|||||.:||
Human    14 ILMITELILASK---SYYDILGVPKSASERQIKKAFHKLAMKYHPDKNK-SPDAEAKFREIAEAY 74

  Fly    77 EILGNYRLRRLYDKGIVHTA----------GAQYAQDVHDVAEPVVED---------DAETKFYK 122
            |.|.:...|:.||. :.|:|          |:.:.|..:...:.:.:|         ....|.::
Human    75 ETLSDANRRKEYDT-LGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFE 138

  Fly   123 SRFQKSRVSDSAGRTPIYDFDEW------------------------SRNHYGKSFDRRQAAQAK 163
            :.||..:  |.......:.|.|:                        |.|.:....:.|....:|
Human   139 NHFQTRQ--DGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSK 201

  Fly   164 YDRIKVQRETNRISGQTD 181
            :.|...||..|.::..||
Human   202 HCRTVTQRRGNMVTTYTD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 28/62 (45%)
DnaJ 27..89 CDD:278647 28/61 (46%)
DNAJB9NP_036460.1 type 2 signal-anchor for ER localization 7..23 2/8 (25%)
DnaJ 26..>136 CDD:333066 35/111 (32%)
Divergent targeting domain. /evidence=ECO:0000250|UniProtKB:Q9QYI6 91..223 21/131 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.