DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and CG3061

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:197 Identity:46/197 - (23%)
Similarity:81/197 - (41%) Gaps:37/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD--- 89
            :|:.||:.:..|.:|||.||.||::..|||:|: :..|.:.|:.:..|..:|.:...|:.||   
  Fly   107 YYEVLGVSKTATDSEIKKAYKKLALQLHPDKNK-APGAVEAFKALGNAAGVLTDAEKRKNYDLYG 170

  Fly    90 ----------KGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDE 144
                      .|..|....||..:.:..:.....|.:..:.:...|.        |..|      
  Fly   171 INESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFN--------GGFP------ 221

  Fly   145 WSRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESSYD-TPK 208
             .:|.:.:...|||  ||:.|     ||.|..|...:::.:..:.....:...|:::..|. ||.
  Fly   222 -QQNVHMRQQRRRQ--QARED-----REGNNSSALVNLLPIVLLIGLSMMSSFFISDPMYSLTPS 278

  Fly   209 QK 210
            .|
  Fly   279 HK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 20/60 (33%)
DnaJ 27..89 CDD:278647 20/60 (33%)
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 30/132 (23%)
DnaJ 106..167 CDD:278647 20/60 (33%)
DUF1977 269..366 CDD:286411 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.