DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajc7

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_009297610.1 Gene:dnajc7 / 406579 ZFINID:ZDB-GENE-040426-2483 Length:522 Species:Danio rerio


Alignment Length:103 Identity:31/103 - (30%)
Similarity:54/103 - (52%) Gaps:23/103 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGS-----ENAAKKFREINQAYE 77
            |.|.:..:..:|..||:.:..|::|||.||.|.::::||||:.|:     :...|||:|:.:|:.
Zfish   401 LELKKSKRKDYYKVLGVDKNATEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFT 465

  Fly    78 ILGNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDD 115
            :|.:.:.:..||.|             ||     :|||
Zfish   466 VLSDPKKKTRYDSG-------------HD-----LEDD 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 21/67 (31%)
DnaJ 27..89 CDD:278647 21/66 (32%)
dnajc7XP_009297610.1 TPR_11 56..121 CDD:290150
TPR 57..90 CDD:197478
TPR repeat 57..85 CDD:276809
TPR_17 79..112 CDD:290167
TPR repeat 90..120 CDD:276809
TPR repeat 125..153 CDD:276809
TPR repeat 174..199 CDD:276809
TPR repeat 210..233 CDD:276809
TPR repeat 238..268 CDD:276809
TPR_11 286..354 CDD:290150
TPR repeat 286..313 CDD:276809
TPR repeat 318..352 CDD:276809
TPR_1 323..356 CDD:278916
TPR repeat 357..385 CDD:276809
DnaJ 409..>497 CDD:223560 29/95 (31%)
DnaJ 410..477 CDD:278647 21/66 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.