Sequence 1: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611986.2 | Gene: | CG2790 / 37992 | FlyBaseID: | FBgn0027599 | Length: | 540 | Species: | Drosophila melanogaster |
Alignment Length: | 250 | Identity: | 60/250 - (24%) |
---|---|---|---|
Similarity: | 103/250 - (41%) | Gaps: | 60/250 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGS-ENAAKKFREINQAYEILGNYRLRRLYD-- 89
Fly 90 -KGIVHTAGAQYAQDVHDVAEPVVED------DAETKFYK--------------------SRF-- 125
Fly 126 ------QKSRVSDSAGRTPIYDFDEWSRNHYGKSFD-----RRQAAQAKYDRIKVQRETNRI--- 176
Fly 177 --SGQTDMV--LLAFI---FAGVAVYLMFL---AESSYDTPKQKAKERYRRDQEE 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 21/61 (34%) |
DnaJ | 27..89 | CDD:278647 | 21/61 (34%) | ||
CG2790 | NP_611986.2 | DnaJ | 3..66 | CDD:278647 | 21/61 (34%) |
ZUO1 | 19..>252 | CDD:227594 | 56/234 (24%) | ||
zf-C2H2_jaz | 313..337 | CDD:288983 | |||
C2H2 Zn finger | 315..337 | CDD:275371 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |