DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and DNAJB13

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_011543306.1 Gene:DNAJB13 / 374407 HGNCID:30718 Length:350 Species:Homo sapiens


Alignment Length:268 Identity:51/268 - (19%)
Similarity:92/268 - (34%) Gaps:98/268 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PLLLLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQA 75
            |.||.||:.:...|.             |..:....|.:|::.:||.:: ...::|:.||:|.:|
Human    35 PSLLDRGVNIHLEHS-------------TAEDKDQRYRRLALKHHPLKS-NEPSSAEIFRQIAEA 85

  Fly    76 YEILGNYRLRRLYDK--------GIVHTAGAQ------YAQDVHDVAEPVVEDDAETKFYKSRFQ 126
            |::|.:...|.:|||        ||....|:|      |.  .|...|.|..:     |:     
Human    86 YDVLSDPMKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYV--FHGKPEKVFHE-----FF----- 138

  Fly   127 KSRVSDSAGRTPIYDFDEWSRNHYGKSFD-------RRQAAQAKYD--------------RIKVQ 170
                   .|..|..:|.:...:....:|.       ::|..|.:.|              :||:.
Human   139 -------GGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLEDLFFGCTKKIKIS 196

  Fly   171 RETNRISGQT----DMVLLAFIFAG-------------------VAVYLMFLAESSYDTPKQKAK 212
            |......|.:    |.:|...:..|                   :...::|:.       |:|..
Human   197 RRVLNEDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPADIIFIV-------KEKLH 254

  Fly   213 ERYRRDQE 220
            .|:||:.:
Human   255 PRFRREND 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 13/62 (21%)
DnaJ 27..89 CDD:278647 13/61 (21%)
DNAJB13XP_011543306.1 DnaJ_bact 48..346 CDD:274090 46/255 (18%)
DnaJ 48..99 CDD:278647 14/64 (22%)
DnaJ_C 174..336 CDD:199909 14/96 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.