DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and mrj

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster


Alignment Length:194 Identity:52/194 - (26%)
Similarity:84/194 - (43%) Gaps:38/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGS-ENAAKKFREINQAYEILGNYRLRRLYD 89
            :.:|..|.:.|..|.:|:|.||.||::.:|||:|..: :.|.|:|||:::|||:|.:.|.||:||
  Fly     2 VDYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYD 66

  Fly    90 KGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYGKSF 154
            .          ...:|..:.........:.:.:.|...:..|.|.||.  ||:|.:..:.||...
  Fly    67 A----------RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRD--YDYDYYPGSGYGSGS 119

  Fly   155 DRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESSYDTPKQKAKERYRRD 218
            .||..              ||....|    ...||.|...:.||       ..|::..:.|.:|
  Fly   120 GRRSG--------------NRYQAFT----FRNIFEGTPFHKMF-------EKKRRIYDEYGKD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 26/63 (41%)
DnaJ 27..89 CDD:278647 26/62 (42%)
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 26/63 (41%)
DnaJ 3..66 CDD:278647 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.