Sequence 1: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245832.1 | Gene: | CG5001 / 33308 | FlyBaseID: | FBgn0031322 | Length: | 350 | Species: | Drosophila melanogaster |
Alignment Length: | 214 | Identity: | 55/214 - (25%) |
---|---|---|---|
Similarity: | 88/214 - (41%) | Gaps: | 71/214 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK-- 90
Fly 91 ------GIVHTAG---------------AQYAQ------------DVHD--VAEPVVEDDAETKF 120
Fly 121 YKSRFQ--KSRVSDSAGRTPIYDFDEWSRNHYGKSF--------DRRQAAQAKYD---------- 165
Fly 166 ----RIKVQRETNRISGQT 180 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 26/60 (43%) |
DnaJ | 27..89 | CDD:278647 | 26/60 (43%) | ||
CG5001 | NP_001245832.1 | DnaJ | 1..347 | CDD:223560 | 55/214 (26%) |
DnaJ | 4..65 | CDD:278647 | 26/60 (43%) | ||
DnaJ_C | 174..338 | CDD:199909 | 4/35 (11%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |