DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and DNAJA1

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001530.1 Gene:DNAJA1 / 3301 HGNCID:5229 Length:397 Species:Homo sapiens


Alignment Length:67 Identity:32/67 - (47%)
Similarity:48/67 - (71%) Gaps:3/67 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD 89
            :.::||.||::...||.|:|.||.||::.||||:|   .|..:||::|:||||:|.:.:.|.|||
Human     4 ETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKN---PNEGEKFKQISQAYEVLSDAKKRELYD 65

  Fly    90 KG 91
            ||
Human    66 KG 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 28/62 (45%)
DnaJ 27..89 CDD:278647 28/61 (46%)
DNAJA1NP_001530.1 PTZ00037 2..394 CDD:240236 32/67 (48%)
CXXCXGXG motif 134..141
CXXCXGXG motif 150..157
CXXCXGXG motif 177..184
CXXCXGXG motif 193..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.