DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajb1b

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_956067.1 Gene:dnajb1b / 327244 ZFINID:ZDB-GENE-030131-5455 Length:337 Species:Danio rerio


Alignment Length:253 Identity:60/253 - (23%)
Similarity:101/253 - (39%) Gaps:73/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK-- 90
            :|..|||::..:.:|||.||.|.::.||||:|: |..|.:||:||.:||::|.:.:.:.:||:  
Zfish     5 YYSVLGIQKGASDDEIKKAYRKQALKYHPDKNK-SAGAEEKFKEIAEAYDVLSDPKKKDIYDRFG 68

  Fly    91 --GIVHTA------GAQYAQ----DVHDVAEPVVEDDAETKFYKSR------------FQKSRVS 131
              |:...|      |..|..    |.|.:.         ::|:..|            ..::..:
Zfish    69 EEGLKGGAPGGGGGGGNYTYTFQGDPHAMF---------SEFFGGRNPFEHIFGHNGGMDENMET 124

  Fly   132 D----SAGRTPIYDFDEWSRNH-YGKSFDRRQAAQAKYD--------------RIKVQRETNRIS 177
            |    |.|...|..|......| :|...:|:|.....:|              ::|:.|:.....
Zfish   125 DDLFASFGMGGIGGFPRSFTTHSHGGRMERKQDPAVIHDLRVSLDEVFTGCTKKMKISRKRLNPD 189

  Fly   178 GQT----DMVLLAFIFAG--VAVYLMFLAESSYDTP-----------KQKAKERYRRD 218
            |:|    |.:|...:..|  ....:.|..|.. :||           |.|....|:||
Zfish   190 GRTTRSEDKILTVEVKKGWKEGTKITFPREGD-ETPSNIPADVVFVLKDKPHPVYKRD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 24/60 (40%)
DnaJ 27..89 CDD:278647 24/60 (40%)
dnajb1bNP_956067.1 DnaJ 1..328 CDD:223560 60/253 (24%)
DnaJ 4..65 CDD:278647 24/60 (40%)
DnaJ_C 160..322 CDD:199909 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.