DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and CG7872

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster


Alignment Length:187 Identity:56/187 - (29%)
Similarity:85/187 - (45%) Gaps:46/187 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSE---NAAKKFREINQA 75
            ||.|||..:.   :.||.||:.|:.:::||..||.:|:..||||.::|:|   .|..:|:.:..|
  Fly    21 LLEGLYCGKE---NCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATA 82

  Fly    76 YEILGNYRLRRLYDKGIVHTAGAQYAQ-------------DVHDVAEPVVEDDAETKFYKSRFQK 127
            ||||.:...|..||. ::....|.||.             ||..|...|:...:..::| |.:|:
  Fly    83 YEILRDEESRTDYDY-MLDNPDAYYAHYYRYYRRRVAPKVDVRVVIVVVLTIVSVIQYY-SGWQR 145

  Fly   128 SRVSDSA----GRTPIYDFDEWSRNHYGKSFDRRQAAQAKYDRI--KVQRE-TNRIS 177
               .|||    ...|.|               |.||.:...|.|  |:|:: .||:|
  Fly   146 ---YDSAIKYFATVPKY---------------RNQALEIARDEIQEKIQKKGKNRMS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 24/65 (37%)
DnaJ 27..89 CDD:278647 24/64 (38%)
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 24/64 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.