Sequence 1: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997842.1 | Gene: | dnajc4 / 324373 | ZFINID: | ZDB-GENE-030131-3093 | Length: | 237 | Species: | Danio rerio |
Alignment Length: | 226 | Identity: | 54/226 - (23%) |
---|---|---|---|
Similarity: | 95/226 - (42%) | Gaps: | 44/226 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 LRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEIL 79
Fly 80 GNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDE 144
Fly 145 WSRNHYGKSFDRRQAAQ-AKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMF--LAESSYDT 206
Fly 207 PKQK----------AKERYRRDQEEREQKLV 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 17/62 (27%) |
DnaJ | 27..89 | CDD:278647 | 17/61 (28%) | ||
dnajc4 | NP_997842.1 | DnaJ | 35..97 | CDD:278647 | 17/61 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |