DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajb12a

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_997824.1 Gene:dnajb12a / 324005 ZFINID:ZDB-GENE-030131-2725 Length:371 Species:Danio rerio


Alignment Length:204 Identity:47/204 - (23%)
Similarity:80/204 - (39%) Gaps:37/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGI 92
            :|:.||:.::.::.::|.||.||::.:|||:|. :..|.:.|:.|..||.:|.|...||.||   
Zfish   109 YYETLGVSKEASEEDLKKAYRKLALKFHPDKNH-APGATEAFKAIGNAYAVLSNPEKRRQYD--- 169

  Fly    93 VHTAGAQYAQDVH-------DVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHY 150
              ..|.:.|...|       :....:..:|....|:...|..|.|                  |.
Zfish   170 --VYGEEKAHPTHRHRTYHRNFEADISPEDLFNMFFGGGFPTSNV------------------HV 214

  Fly   151 GKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESSYDTPKQKAKERY 215
            ..:...|...|.:::|.:.|||    .|....|.|..|.  :.:.:..|::....:|......|.
Zfish   215 YSNGRMRFGHQQRHERQEQQRE----GGLALFVQLMPIL--ILIIVSALSQMMVSSPPYSLSHRP 273

  Fly   216 RRDQEEREQ 224
            ......|.|
Zfish   274 SLGHTSRRQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 21/60 (35%)
DnaJ 27..89 CDD:278647 21/60 (35%)
dnajb12aNP_997824.1 DnaJ 107..>211 CDD:223560 29/107 (27%)
DnaJ 108..169 CDD:278647 21/60 (35%)
DUF1977 263..363 CDD:286411 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.