DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajc11a

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_997796.1 Gene:dnajc11a / 322953 ZFINID:ZDB-GENE-030131-1673 Length:563 Species:Danio rerio


Alignment Length:130 Identity:38/130 - (29%)
Similarity:68/130 - (52%) Gaps:14/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSE---NAAKKFREINQAYEILGNYRLRRLYD 89
            :|..|.:||:.||.|:||:|.:|.||||||:::..|   .|.:.|..::||||:|.:.:.|.:||
Zfish    15 YYSLLNVRREATQEELKASYRRLCMLYHPDKHRDPELKKQAEQLFNLVHQAYEVLSDPQARAIYD 79

  Fly    90 ----KGIVHTAGAQYAQ------DVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDE 144
                ||: ...|.:..:      ::.:..|.:..:..|.:..:....|..:|.....|.::|:.|
Zfish    80 IYGKKGL-DVEGWEVVERKRTPAEIREEYERLQREREERRLQQRTNPKGTISVGIDATDLFDYYE 143

  Fly   145  144
            Zfish   144  143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 26/63 (41%)
DnaJ 27..89 CDD:278647 26/63 (41%)
dnajc11aNP_997796.1 DnaJ 14..79 CDD:278647 26/63 (41%)
DUF3395 421..553 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.